PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_15651.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 179aa    MW: 20210.4 Da    PI: 7.0681
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_15651.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM39.71.5e-1214286128
                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tg dk+v+s +   vglkk+Lv+y g+a kg+ktdW+mhe+rl
  Rsa1.0_15651.1_g00001.1   1 TGIDKPVYS-NLDCVGLKKSLVYYLGSAGKGSKTDWMMHEFRL 42 
                              7999*****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-17164IPR003441NAC domain
PROSITE profilePS5100521.361165IPR003441NAC domain
PfamPF023651.0E-41442IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
TGIDKPVYSN LDCVGLKKSL VYYLGSAGKG SKTDWMMHEF RLPSSSESPT PQAAEVWTLC  60
RIFKRVTHHR NPTIVQPNRR PVITLTDSGS KTSSLDSDHT SHHVVESLSH KLHEPQFQPQ  120
TQNPYYNQLT TVGFNQPTYN TCHENNFLNL WNINGGDFIG DATSWDELRS VIDGNTNHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-13165101165NO APICAL MERISTEM PROTEIN
1ut4_B3e-13165101165NO APICAL MERISTEM PROTEIN
1ut7_A3e-13165101165NO APICAL MERISTEM PROTEIN
1ut7_B3e-13165101165NO APICAL MERISTEM PROTEIN
3swm_A3e-13165104168NAC domain-containing protein 19
3swm_B3e-13165104168NAC domain-containing protein 19
3swm_C3e-13165104168NAC domain-containing protein 19
3swm_D3e-13165104168NAC domain-containing protein 19
3swp_A3e-13165104168NAC domain-containing protein 19
3swp_B3e-13165104168NAC domain-containing protein 19
3swp_C3e-13165104168NAC domain-containing protein 19
3swp_D3e-13165104168NAC domain-containing protein 19
4dul_A3e-13165101165NAC domain-containing protein 19
4dul_B3e-13165101165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142151.11e-113PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK552e-89NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A078H0L41e-113A0A078H0L4_BRANA; BnaA04g24740D protein
TrEMBLM4F9I01e-113M4F9I0_BRARP; Uncharacterized protein
STRINGBra037743.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-79NAC domain containing protein 42